Documents in the NTIS Technical Reports collection are the results of federally funded research. They are directly submitted to or collected by NTIS from Federal agencies for permanent accessibility to industry, academia and the public.  Before purchasing from NTIS, you may want to check for free access from (1) the issuing organization's website; (2) the U.S. Government Printing Office's Federal Digital System website http://www.gpo.gov/fdsys; (3) the federal government Internet portal USA.gov; or (4) a web search conducted using a commercial search engine such as http://www.google.com.
Accession Number ADA583577
Title Bioeffects of Gold Nanorods as a Function of Aspect Ratio and Surface Chemistry.
Publication Date Nov 2012
Media Count 83p
Personal Author B. Maurer C. Grabinski E. Untener S. Hussain
Abstract One of the major challenges to the use of nanoparticles as drug delivery agents is that nanoparticles often become trapped in endosomes; unable to reach their desired target. Functionalization of gold nanorods (GNRs) was used in this study to attempt delivery outside of endosomes as well as study the role of surface chemistry and aspect ratio (AR) on bio-effects relevant to delivery applications. GNRs were used in this study due to their unique optical properties and enhanced delivery abilities. GNRs were synthesized with ARs 3 and 6 and functionalized with negatively charged tannic acid (TA) and carboxylic acid (COOH) as well as positively charged TAT (transactivator of transcription peptide with the sequence: GRKKRRQRRRPQ) and TAT HA2 (hemaglutanin peptide with the sequence: RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG). After functionalization all the GNRs used in the study were biocompatible, making them applicable for biological applications. The cellular uptake of GNRs into keratinocytes was dependent on both AR and surface charge. AR 6 GNRs showed quantitatively higher uptake than AR 3 GNRs. Additionally, positively charged GNRs had higher uptake than negatively charged GNRs. Further studies showed that surface chemistry played a role in the uptake pathway used. TAT, TAT HA2, and COOH GNRs were uptaken by a variety of mechanisms of endocytosis. TA GNRs, however, were uptaken independently of endocytosis resulting in a unique orientation of TA GNRs within cells. This result makes TA GNRs extremely useful for the development of delivery, bio-imaging, and therapeutic applications.
Keywords Aspect ratio
Bioeffects
Carboxylic acids
Cells(Biology)
Cellular uptake
Delivery
Delivery agents
Drug delivery
Endocytosis
Functionalization
Gold nanorods
Keratinocytes
Nanoparticle agglomeration
Nanoparticles
Optical properties
Peptides
Physiological effects
Reagents
Subcellular delivery
Surface chemistry
Synthesis(Chemistry)
Tannic acid
Targeted cell deliveryWuafrloafwp000
Toxicity


 
Source Agency Non Paid ADAS
NTIS Subject Category 57A - Anatomy
57S - Physiology
57Q - Pharmacology & Pharmacological Chemistry
99F - Physical & Theoretical Chemistry
Corporate Author Air Force Research Lab., Wright-Patterson AFB, OH. Human Effectiveness Directorate.
Document Type Technical report
Title Note Interim rept. May 2011-Nov 2012.
NTIS Issue Number 1401
Contract Number N/A

Science and Technology Highlights

See a sampling of the latest scientific, technical and engineering information from NTIS in the NTIS Technical Reports Newsletter

Acrobat Reader Mobile    Acrobat Reader